PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00007g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 116aa    MW: 13279.7 Da    PI: 5.0302
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00007g00016.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.71.9e-261060151
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                              kpr +Wt eLHe+Fv+av++LGG+ +AtPk+i+++m+ +++t eh+kSHLQ
  Peaxi162Scf00007g00016.1 10 KPRFKWTVELHEHFVKAVNELGGPYEATPKNIMKFMDDEDITTEHIKSHLQ 60
                              79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-23960IPR009057Homeodomain-like
SuperFamilySSF466892.33E-13967IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-201061IPR006447Myb domain, plants
PfamPF002498.6E-71460IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
VVSTHDLNRK PRFKWTVELH EHFVKAVNEL GGPYEATPKN IMKFMDDEDI TTEHIKSHLQ  60
VIDEAIQKEN LENKEKQEMH TDATASIELQ AKEESSSSTL KGGDNDKGDD NKLKNY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010324098.11e-34PREDICTED: protein PHR1-LIKE 1-like
TrEMBLM1A7P51e-36M1A7P5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000164644e-36(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120621623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.13e-18G2-like family protein